Lokad.Lython
0.6.0
Prefix Reserved
See the version list below for details.
dotnet add package Lokad.Lython --version 0.6.0
NuGet\Install-Package Lokad.Lython -Version 0.6.0
<PackageReference Include="Lokad.Lython" Version="0.6.0" />
<PackageVersion Include="Lokad.Lython" Version="0.6.0" />
<PackageReference Include="Lokad.Lython" />
paket add Lokad.Lython --version 0.6.0
#r "nuget: Lokad.Lython, 0.6.0"
#:package Lokad.Lython@0.6.0
#addin nuget:?package=Lokad.Lython&version=0.6.0
#tool nuget:?package=Lokad.Lython&version=0.6.0
Lython
Lython is an embeddable, contained-by-design Python runtime implemented in managed C# on .NET. It compiles a supported Python subset through a handwritten front-end and executes it through a pure managed interpreter, with file and path effects mediated by an async host-provided interface.
dotnet add package Lokad.Lython
Release notes are tracked in CHANGELOG.md.
It is meant for the kind of Python a coding agent naturally writes when it needs to:
- read and rewrite text files
- scan directories
- reshape CSV or TSV data
- apply regex-based edits
- produce derived output files
The runtime is intentionally host-mediated. Scripts do not get ambient access to the local machine. File and path effects go through ILythonHost, and the supported module surface stays small and explicit.
Representative Script
This is the sort of concise Python Lython is meant to run:
import csv
import re
from json import dumps
with open("inventory.tsv") as handle:
rows = csv.reader(handle.read().splitlines(), delimiter="\t")
def clean_name(text, *, pattern=r"\s+"):
return re.sub(pattern=pattern, repl=" ", string=text.strip())
selected = []
for sku, name, qty in rows[1:]:
if (count := int(qty)) > 0:
selected.append({"sku": sku, "name": clean_name(name), "qty": count})
else:
selected = sorted(selected, key=lambda item: item["sku"])
writer = csv.writer(delimiter="\t")
writer.writerow(["sku", "name", "qty"])
writer.writerows([[item["sku"], item["name"], item["qty"]] for item in selected])
with open("available.tsv", "w") as handle:
handle.write(writer.getvalue())
with open("available.json", "w") as handle:
handle.write(dumps(obj=selected))
On the host side, the plumbing is deliberately small:
var engine = new LythonEngine();
var result = engine.Run(script, host);
if (!result.Success)
{
Console.WriteLine($"{result.Failure!.ExceptionType}: {result.Failure.Message}");
}
The example elides the host implementation on purpose. In practice, host is your controlled bridge to files and directories through ILythonHost.
Python Surface
Lython supports a broad, practical subset of Python. Ordinary control flow, functions, exceptions, collections, comprehensions, strings, regex, classes and dataclasses, structural pattern matching, and host-mediated file/path work are expected to work.
Dataclasses include direct decorators, runtime dataclasses.dataclass(cls) wrapping, helper APIs such as fields, asdict, astuple, replace, and make_dataclass, and ordinary inheritance. Layout-changing options such as slots=True and weakref_slot=True are diagnosed as unsupported.
typing is compatibility-oriented: common aliases and helpers are importable, subscriptable, printable, and usable in annotations, but they do not enforce runtime types or protocol checks.
The builtin module surface is explicitly allowlisted:
argparsecollectionscopycsvdataclassesdatetimedecimaldifflibfnmatchfunctoolsglobitertoolsjsonmathoperatoropenpyxlfor contained.xlsxworkbook automationospathlibpkgutilrandomreshutilstatisticssubprocesswhen the host provides a subprocess capabilitysystyping
Local script imports are separate from builtin modules. Bare import helper can resolve through the host as helper.py only when LythonRunOptions.AllowedLocalModules contains helper, so embedders provide an explicit dependent-script list.
pkgutil follows the same contained model: it discovers builtins and explicitly allowed host-backed .py files or package directories, and it does not expose ambient importers or binary resource reads.
datetime covers the common date, time, datetime, timedelta, timezone, and tzinfo surface with CPython-shaped formatting and ISO parsing for fixed-offset timezones. Host-clock APIs such as today(), now(), fromtimestamp(), timestamp() for naive values, and astimezone() are mediated through ILythonHost; Lython does not expose an ambient IANA timezone database.
statistics covers common averages, medians, modes, variance, standard deviation, quantiles, covariance, correlation, linear regression, and NormalDist. Numeric summary helpers coerce supported real inputs, including decimal.Decimal, to double when needed; empty data, singleton sample statistics, invalid quantile parameters, degenerate correlation/regression, and zero-sigma distribution methods raise CPython-shaped errors. NormalDist.samples(...) is deterministic when no seed is supplied, and KDE helpers fail explicitly.
random is deterministic by design. It exposes module-level helpers and independent Random instances, state snapshot/restore, randbytes, sample(..., counts=...), stricter choices validation, and common distribution helpers. SystemRandom remains explicitly unsupported unless a future host entropy abstraction is added.
sys is also contained: metadata, path, modules, builtin module names, exc_info(), getsizeof(...), and std streams describe Lython and host-mediated handles rather than the host process or an ambient CPython installation.
collections covers the common agent-authored container helpers: defaultdict, Counter, deque, namedtuple, insertion-ordered OrderedDict as a dict-shaped alias, ChainMap, and inert collections.abc import names. Counter arithmetic follows positive-count CPython rules, bounded deque(maxlen=...) evicts consistently, and UserDict, UserList, and UserString fail explicitly.
copy supports copy, deepcopy(x, memo=None), copy.replace(obj, **changes), Error/error, and a compatibility dispatch_table. Deep copies preserve cycles and explicit memo dictionaries, replace works for dataclasses, namedtuple-like values, and __replace__ hooks, and pickle-style reduce/state protocols fail explicitly unless a direct copy hook is provided.
shutil covers host-mediated file-copy and move workflows: copyfile, copy, move, text-only copyfileobj, Error, and SameFileError. Metadata-preserving copy2, symlink behavior, recursive tree helpers, archive helpers, permission helpers, and raw host inspection helpers remain outside the contained path model.
functools covers wrapper metadata helpers, total_ordering, reduce, partial, partialmethod, cmp_to_key, lru_cache, cache, cached_property, simple singledispatch and singledispatchmethod registration, and recursive_repr. Cache keys use Lython's hashable-value rules; functools.Placeholder is exposed only to fail explicitly because placeholder partial application is outside the supported subset.
re is Unicode text-only and backed by Utf8Regex.PythonRe. It exposes common module helpers, compiled patterns, lazy finditer, Python-shaped Pattern and Match metadata, named and optional group helpers, callable and template replacements, catchable re.error/PatternError, and the usual integer flags. re.LOCALE and re.DEBUG fail explicitly; bytes patterns and subjects remain outside the public bytes boundary.
fnmatch is deterministic and platform-independent. fnmatch.fnmatch, fnmatch.fnmatchcase, and filter use POSIX-like case-sensitive matching with *, ?, bracket classes, negated classes, and ranges; translate returns an anchored regex string compatible with Lython re.
json covers text-only load/dump for Lython file handles, loads/dumps, catchable JSONDecodeError fields, parse/object hooks, formatting controls, key sorting/conversion, skipkeys, default, allow_nan, and circular-reference checks. JSONEncoder and JSONDecoder are exposed as explicit unsupported custom-class stubs.
itertools covers common lazy data-wrangling helpers: chain, islice, product, zip_longest, count, repeat, cycle, combinatorics, accumulate, selectors/predicates, starmap, pairwise, groupby, tee, and batched. Unbounded iterators remain lazy; functions that must cache inputs or buffers are still subject to Lython's execution limits.
os follows the same contained path and environment model. Path helpers use Lython's normalized POSIX-like / semantics; os.environ, getenv, putenv, unsetenv, get_exec_path, and expandvars read only the optional LythonRunOptions.Environment map and never the ambient process environment. Permission, symlink, raw file descriptor, process identity, signal, chdir, and shell helpers fail explicitly.
decimal is compatibility-oriented over .NET's fixed-precision decimal, not CPython's arbitrary-precision engine. Common Decimal, DecimalTuple, context, rounding constant, predicate, tuple-conversion, and integral-rounding APIs are available for agent-authored scripts. NaN, sNaN, Infinity, and precision beyond the .NET decimal range fail explicitly.
math tracks the common CPython 3.13 scalar and aggregate helpers used in generated scripts, including integer combinatorics, dist, variadic hypot, frexp/ldexp/modf, IEEE-adjacent helpers, gamma/lgamma, fma, and sumprod. Exact combinatorics are arbitrary-size where practical, but computations that imply unbounded local loops fail explicitly under Lython's contained execution model.
operator covers direct-function equivalents for supported unary, binary, comparison, item, sequence, in-place, and callable operations, including itemgetter, attrgetter, methodcaller, and operator.call. The helpers reuse Lython's existing expression and augmented-assignment semantics; matmul fails explicitly because Lython does not support the matrix-multiplication operator.
glob is host-mediated over the same contained path model. Module-level glob.glob(...) returns Python strings, glob.iglob(...) returns a one-shot iterator over materialized string results, and relative patterns return relative paths. root_dir, recursive, include_hidden, escape, has_magic, and translate are supported; dir_fd, glob0, and glob1 fail explicitly.
pathlib uses Lython's normalized /-separated path model over host-mediated files and directories. Path, PurePath, PurePosixPath, and PosixPath share that model; Windows path classes fail explicitly. Path.cwd() uses the host cwd, home() and expanduser() stay unsupported, globbing APIs materialize lists eagerly, and file handles are UTF-8 text-only with explicit unsupported diagnostics for binary, symlink, permission, and random-access operations.
argparse covers ordinary agent-authored CLI scripts: ArgumentParser, Namespace, text-only FileType, common formatter classes and constants, parse_args, parse_known_args, defaults, help/error formatting, short and long options, --name=value, compact short flags, choices, required options, typed values, and the usual store, append, store_const, store_true, store_false, count, and version actions. Advanced parser composition features such as from-file expansion, parent parsers, subparsers, conflict handlers, and custom Action subclasses are rejected explicitly.
Intentionally unsupported or constrained:
- arbitrary package loading
- unrestricted imports from disk
- sockets and HTTP
- broad shell/process authority beyond the host-mediated
subprocesssurface yieldand async/await- parts of Python metaprogramming and object-model edge behavior outside the contained runtime model
- a full general-purpose Python standard library
When a construct is outside the supported subset, Lython fails explicitly rather than silently drift away from Python semantics.
Static Analysis
Compile(...) runs an error-only static analyzer before a script can execute. The analyzer is conservative: it rejects provable mistakes, but does not try to be a complete Python type checker.
It is aimed at the failures coding agents are most likely to introduce in small automation scripts: unsupported imports, bad call shapes, wrong statically-known argument types for supported built-ins and modules, sealed member typos, dataclass and argparse shape mistakes, regex match/group misuse, and exact literal dictionary key misses. Unknown or data-dependent cases are left to runtime instead of guessed.
Public API
The main entry point is LythonEngine. The public surface is intentionally small:
Compile(...)returns aLythonCompiledScriptand performs no host effectsRun(...)andRunAsync(...)return aLythonExecutionResult- failures are reported as structured
LythonRuntimeFailure - file and path effects are mediated through
ILythonHost - CLI-style arguments, script origin, and a contained environment map can be passed through
LythonRunOptions print(...)is captured deterministically throughLythonExecutionResult.StandardOutputstderris captured throughLythonExecutionResult.StandardError- projected return values stay CLR-friendly, including
byte[]for Python bytes values - execution limits are configured through
LythonRunOptions
The important runtime guarantees are:
- cooperative interruption through
CancellationToken, with frequent checks across interpreter execution - an explicit execution-step budget to stop runaway pure-Python loops
- a recursion limit plus an internal interpreter-stack guard so Python recursion cannot turn into CLR stack overflow
- conservative in-process size controls for strings, collections, host calls, and execution-memory growth
Unless DisableDefaultLimits is set, Lython applies practical defaults, including a 1 GiB execution-memory budget and a separate 1 GiB projection budget. Those guarantees are meant to make Lython safe to embed inside a host process, while keeping the programming model close to ordinary small Python.
Host Integration
ILythonHost is the authority boundary of the runtime. Core filesystem and clock operations stay small:
- current working directory and wall-clock access
- UTF-8 text reads/writes/appends and binary reads/writes
- existence, stat, directory listing, mkdir, remove, copy, and move
All host effects are async and receive the run cancellation token. That base surface is enough for the built-in text/file/path workflows. The richer host-mediated features are optional and exposed through default interface members:
StandardInput,StandardOutput, andStandardErrorWalkAsync(...)foros.walkSubprocessRunnerfor the host-mediatedsubprocessmodule surface
The stream capability is deliberately text-shaped:
ILythonTextInputexposesReadToEndUtf8Async(...)andReadLineUtf8Async(...)ILythonTextOutputexposesWriteUtf8Async(...)andFlushAsync(...)
When those are provided:
sys.stdin,sys.stdout, andsys.stderrexistinput()reads from host stdinprint()writes tosys.stdoutprint(..., file=sys.stderr)works naturally
Process execution is also optional and host-mediated. ILythonSubprocessRunner receives a LythonSubprocessRequest with:
- argv as
IReadOnlyList<string> - optional cwd
- optional environment
- UTF-8 stdin bytes
- stdin/stdout/stderr stream modes
- shell/text-mode flags
- optional encoding and error-mode requests
- optional timeout
- optional max-output bound
and returns a LythonSubprocessResult with return code plus captured UTF-8 stdout/stderr.
The subprocess contract remains host-mediated:
subprocess.run(...),subprocess.call(...),subprocess.check_call(...), andsubprocess.check_output(...)subprocess.CompletedProcess,subprocess.CalledProcessError, andsubprocess.SubprocessErrorsubprocess.PIPE,subprocess.STDOUT, andsubprocess.DEVNULLsubprocess.list2cmdline(...)- string and
pathlib.Pathcommand parts shell=Trueas an explicit host request, not ambient shell authority- text-oriented captured I/O
- no
Popen,TimeoutExpired,getoutput, orgetstatusoutput - no background or async process model
This keeps Lython pipe-friendly without giving scripts ambient process authority. The embedding host decides whether subprocesses are available at all, and under what policy.
import openpyxl provides a vanilla-Python-shaped subset for common .xlsx
workbook automation. Workbook load/save uses host-mediated binary file
operations and does not add workbook-specific package dependencies.
Safety Guarantees
Lython is designed to fail inside the runtime rather than by escaping into unmanaged process behavior in the normal supported envelope.
- file and path effects are host-mediated through
ILythonHost; scripts do not get ambient machine authority - an error-only static analyzer rejects many provable incompatibilities and structural mistakes before execution starts, instead of failing halfway through the script
- cancellation is cooperative and checked frequently enough to stop runaway pure-Python work
- execution steps, recursion depth, interpreter depth, host calls, string lengths, and collection sizes can all be bounded explicitly
- the main script-owned allocators and large
BigIntegergrowth paths are governed by an execution-memory budget, so large runtime materializations fail as ordinaryRuntimeErrorresults - host-facing projection is governed separately through an optional projection budget, and projection overflow surfaces distinctly as
ProjectionError
The model is intentionally conservative, not omniscient. Lython does not try to mirror the CLR heap perfectly, but it does aim to keep the main script-owned growth paths inside explicit runtime control.
Dependencies
Lokad.Parsingfor tokenization and the handwritten front-end infrastructureLokad.Utf8Regexfor UTF-8-native regex execution primitivesLokad.Utf8Regex.PythonRefor Python-shaped regular-expression semantics on top of UTF-8 regex execution
| Product | Versions Compatible and additional computed target framework versions. |
|---|---|
| .NET | net10.0 is compatible. net10.0-android was computed. net10.0-browser was computed. net10.0-ios was computed. net10.0-maccatalyst was computed. net10.0-macos was computed. net10.0-tvos was computed. net10.0-windows was computed. |
-
net10.0
- Lokad.Parsing (>= 1.1.0)
- Lokad.Utf8Regex.PythonRe (>= 0.2.0)
NuGet packages
This package is not used by any NuGet packages.
GitHub repositories
This package is not used by any popular GitHub repositories.
0.6.0 expands Python-shaped script compatibility with contained shutil support, removal of Lython-specific filesystem globals, additional numeric/text/iterator/object builtins, broader builtin exception categories, and refreshed builtin/spec contracts while preserving host-mediated containment.